PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g27110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 258aa    MW: 28531.8 Da    PI: 8.3015
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g27110genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.34.4e-18174208135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  Tp4g27110 174 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 208
                *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.0E-902257IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.306168204IPR000679Zinc finger, GATA-type
SMARTSM004013.5E-15168218IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.5E-13172206IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.71E-14172232No hitNo description
CDDcd002025.64E-14173220No hitNo description
PROSITE patternPS003440174199IPR000679Zinc finger, GATA-type
PfamPF003207.1E-16174208IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MDVYGLSSPD LLRIDDLLDF SNEDIFSASS STSTAATSSS SFPPPQNPSF HHHHHHHLPS  60
SADHSFLHDI CVPSDDAAHL EWLSQFVDDS FADFPANPLG GTMTSVKTET SFPGKPRSKR  120
SRVPAAFAGT WAPMSESDQQ IHVAGKFKPK KEHSGGGGRH QSSAETAEGG MRRCTHCASE  180
KTPQWRTGPL GPKTLCNACG VRFKSGRLVP EYRPASSPTF VLTQHSNSHR KVMELRRQKE  240
VMRQPHQVQL HHHHHPPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935900.0AB493590.1 Arabidopsis thaliana At2g45050 mRNA for hypothetical protein, partial cds, clone: RAAt2g45050.
GenBankAK3171340.0AK317134.1 Arabidopsis thaliana AT2G45050 mRNA, complete cds, clone: RAFL21-72-C19.
GenBankBT0009210.0BT000921.1 Arabidopsis thaliana clone C105099 putative GATA-type zinc finger transcription factor (At2g45050) mRNA, complete cds.
GenBankY136490.0Y13649.1 Arabidopsis thaliana mRNA for GATA transcription factor 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397685.11e-156hypothetical protein EUTSA_v10001591mg
SwissprotO497411e-136GATA2_ARATH; GATA transcription factor 2
TrEMBLV4LH941e-156V4LH94_EUTSA; Uncharacterized protein
STRINGBra004886.1-P1e-150(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32032666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-115GATA transcription factor 2